PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000202143
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 416aa    MW: 46579.5 Da    PI: 5.3254
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000202143genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-09244291653
                    S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
       Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                    +++k q+e+Le++++k++ p+ ++   + + ++L+ ++V  WF  +R 
  MDP0000202143 244 RLKKAQVETLESVYRKTKRPTNAMVSSIVHVTNLPRKRVVKWFEDKRS 291
                    67899****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.058236296IPR001356Homeobox domain
SuperFamilySSF466894.71E-9242294IPR009057Homeodomain-like
CDDcd000861.67E-6242290No hitNo description
SMARTSM003893.0E-4242300IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-8243292IPR009057Homeodomain-like
PfamPF000465.4E-7244291IPR001356Homeobox domain
PfamPF156975.3E-12323402IPR031421Protein of unknown function DUF4666
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MAFASALNTP KGLHFLPLPS SLRERPPTNL VLPRHFPTRF SSTLALARRR NHRAEVAPSK  60
TKIRKKILGK KEVKEAEVEV EEEDVNEDAI DALFRLLEED LKNDDASFDD EDLTEEELAK  120
LEQEVAEALG IDGDDDDVDD DDDDDEEEDD DDDDIKTLAA ELCLDRAVVL ELLREPPPSL  180
LMMCAALPDE PATVISVSQT KSVETVVETT RETVVETATD SVKLEPAVKV PVHVRQQKFS  240
AQKRLKKAQV ETLESVYRKT KRPTNAMVSS IVHVTNLPRK RVVKWFEDKR SEEGVPDSRI  300
GITTIPAQTK YHHKFTTVQE KAMATLARSA STFRRQGSSG LIWDDKLVLQ REGGRADSRE  360
LRPCQSAKPG GLEAYSHSNA SLAACPRSRS VPTKNPNSFK SKFLKMFHAL FRKSDA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A061GPW05e-82A0A061GPW0_THECC; Overexpressor of cationic peroxidase 3, putative
STRINGVIT_04s0008g05190.t017e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101813138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-38overexpressor of cationic peroxidase 3